SCOP 1.75: Domain d1s7wa2: 1s7w A:1-181

Lineage for d1s7wa2 (1s7w A:1-181)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
Domain d1s7wa2: 1s7w A:1-181 [98692]
Other proteins in same PDB: d1s7wa1, d1s7wb_, d1s7wd1, d1s7we_, d1s7wg1, d1s7wh_, d1s7wj1, d1s7wk_

Details for d1s7wa2

PDB Entry: 1s7w (more details), 2.4 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1s7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7wa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1s7wa2:

Click to download the PDB-style file with coordinates for d1s7wa2.
(The format of our PDB-style files is described here.)

Timeline for d1s7wa2: