SCOP 1.69: Domain d1s7ug1: 1s7u G:182-274

Lineage for d1s7ug1 (1s7u G:182-274)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d1s7ug1: 1s7u G:182-274 [98679]
   Other proteins in same PDB: d1s7ua2, d1s7ub_, d1s7ud2, d1s7ue_, d1s7ug2, d1s7uh_, d1s7uj2, d1s7uk_

Details for d1s7ug1

PDB Entry: 1s7u, 2.2 Å

PDB Description: Crystal structures of the murine class I major histocompatibility complex H-2Db in complex with LCMV-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ug1:

Sequence; same for both SEQRES and ATOM records:

>d1s7ug1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1s7ug1:

• d1s7ug1 first appeared in SCOP 1.67
  
• d1s7ug1 appears in SCOP 1.71
  
• d1s7ug1 appears in the current release, SCOPe 2.08