SCOP 1.69: Domain d1s7te_: 1s7t E:

Lineage for d1s7te_ (1s7t E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)

8. Domain d1s7te_: 1s7t E: [98672]
   Other proteins in same PDB: d1s7ta1, d1s7ta2, d1s7td1, d1s7td2

Details for d1s7te_

PDB Entry: 1s7t, 2.3 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7te_:

Sequence; same for both SEQRES and ATOM records:

>d1s7te_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1s7te_:

• d1s7te_ first appeared in SCOP 1.67
  
• d1s7te_ appears in SCOP 1.71
  
• d1s7te_ appears in the current release, SCOPe 2.08