SCOPe 2.06: Domain d1s7sa1: 1s7s A:182-276

Lineage for d1s7sa1 (1s7s A:182-276)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d1s7sa1: 1s7s A:182-276 [98664]
   Other proteins in same PDB: d1s7sa2, d1s7sb_

Details for d1s7sa1

PDB Entry: 1s7s, 1.99 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1s7sa1:

Sequence; same for both SEQRES and ATOM records:

>d1s7sa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

Timeline for d1s7sa1:

• d1s7sa1 first appeared in SCOP 1.67
  
• d1s7sa1 appears in SCOPe 2.05
  
• d1s7sa1 appears in SCOPe 2.07
  
• d1s7sa1 appears in the current release, SCOPe 2.08