Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries) |
Domain d1s7rd2: 1s7r D:1-181 [98662] Other proteins in same PDB: d1s7ra1, d1s7rb_, d1s7rd1, d1s7re_ |
PDB Entry: 1s7r (more details), 2.95 Å
SCOP Domain Sequences for d1s7rd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7rd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1s7rd2:
View in 3D Domains from other chains: (mouse over for more information) d1s7ra1, d1s7ra2, d1s7rb_, d1s7re_ |