Lineage for d1s7qa2 (1s7q A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856645Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 856659Domain d1s7qa2: 1s7q A:1-181 [98656]
    Other proteins in same PDB: d1s7qa1, d1s7qb_

Details for d1s7qa2

PDB Entry: 1s7q (more details), 1.99 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1s7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7qa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1s7qa2:

Click to download the PDB-style file with coordinates for d1s7qa2.
(The format of our PDB-style files is described here.)

Timeline for d1s7qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s7qa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1s7qb_