Lineage for d1s7bh_ (1s7b H:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746587Fold f.39: Multidrug resistance efflux transporter EmrE [103480] (1 superfamily)
    oligomeric fold; 3 transmembrane helices per subunit
  4. 746588Superfamily f.39.1: Multidrug resistance efflux transporter EmrE [103481] (1 family) (S)
  5. 746589Family f.39.1.1: Multidrug resistance efflux transporter EmrE [103482] (1 protein)
  6. 746590Protein Multidrug resistance efflux transporter EmrE [103483] (1 species)
  7. 746591Species Escherichia coli [TaxId:562] [103484] (1 PDB entry)
  8. 746599Domain d1s7bh_: 1s7b H: [98641]

Details for d1s7bh_

PDB Entry: 1s7b (more details), 3.8 Å

PDB Description: Structure of the Multidrug Resistance Efflux Transporter EmrE from Escherichia coli
PDB Compounds: (H:) EmrE protein

SCOP Domain Sequences for d1s7bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7bh_ f.39.1.1 (H:) Multidrug resistance efflux transporter EmrE {Escherichia coli [TaxId: 562]}
yiylggailaevigttlmkfsegftrlwpsvgtiicycasfwllaqtlayiptgiayaiw
sgvgivlisllswgffgqrldlpaiigmmlicagvliinllsrstph

SCOP Domain Coordinates for d1s7bh_:

Click to download the PDB-style file with coordinates for d1s7bh_.
(The format of our PDB-style files is described here.)

Timeline for d1s7bh_: