Lineage for d1s79a_ (1s79 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862137Protein Lupus LA protein [89940] (1 species)
  7. 862138Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 862150Domain d1s79a_: 1s79 A: [98632]
    central RBD

Details for d1s79a_

PDB Entry: 1s79 (more details)

PDB Description: solution structure of the central rrm of human la protein
PDB Compounds: (A:) Lupus La protein

SCOP Domain Sequences for d1s79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s79a_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
grwilkndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfd
siesakkfvetpgqkyketdllilfkddyfakkneerkqnkve

SCOP Domain Coordinates for d1s79a_:

Click to download the PDB-style file with coordinates for d1s79a_.
(The format of our PDB-style files is described here.)

Timeline for d1s79a_: