Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Lupus LA protein [89940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries) |
Domain d1s79a_: 1s79 A: [98632] central RBD |
PDB Entry: 1s79 (more details)
SCOP Domain Sequences for d1s79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s79a_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} grwilkndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfd siesakkfvetpgqkyketdllilfkddyfakkneerkqnkve
Timeline for d1s79a_: