Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1s78e2: 1s78 E:108-214 [98629] Other proteins in same PDB: d1s78a1, d1s78a2, d1s78a3, d1s78a4, d1s78b1, d1s78b2, d1s78b3, d1s78b4, d1s78c1, d1s78d1, d1s78d2, d1s78e1, d1s78f1, d1s78f2 part of anti-ERBb2 Fab Pertuzumab complexed with nag |
PDB Entry: 1s78 (more details), 3.25 Å
SCOPe Domain Sequences for d1s78e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s78e2 b.1.1.2 (E:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1s78e2: