Lineage for d1s78b4 (1s78 B:489-577)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257965Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2257966Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2257997Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 2257998Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries)
  8. 2258004Domain d1s78b4: 1s78 B:489-577 [98623]
    Other proteins in same PDB: d1s78a1, d1s78a2, d1s78b1, d1s78b2, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2
    complexed with nag

Details for d1s78b4

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex
PDB Compounds: (B:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1s78b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s78b4 g.3.9.1 (B:489-577) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
chqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhclpchpecqpq
ngsvtcfgpeadqcvacahykdppfcvar

SCOPe Domain Coordinates for d1s78b4:

Click to download the PDB-style file with coordinates for d1s78b4.
(The format of our PDB-style files is described here.)

Timeline for d1s78b4: