Lineage for d1s78b2 (1s78 B:323-488)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1583962Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1583992Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)
  7. 1583993Species Human (Homo sapiens) [TaxId:9606] [82329] (2 PDB entries)
  8. 1583999Domain d1s78b2: 1s78 B:323-488 [98621]
    Other proteins in same PDB: d1s78a3, d1s78a4, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2
    complexed with nag

Details for d1s78b2

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex
PDB Compounds: (B:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1s78b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s78b2 c.10.2.5 (B:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle
eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg
lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla

SCOPe Domain Coordinates for d1s78b2:

Click to download the PDB-style file with coordinates for d1s78b2.
(The format of our PDB-style files is described here.)

Timeline for d1s78b2: