Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (8 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (4 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein Protooncoprotein Her2 extracellular domain [82328] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82329] (2 PDB entries) |
Domain d1s78b2: 1s78 B:323-488 [98621] Other proteins in same PDB: d1s78a3, d1s78a4, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2 |
PDB Entry: 1s78 (more details), 3.25 Å
SCOP Domain Sequences for d1s78b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s78b2 c.10.2.5 (B:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)} lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla
Timeline for d1s78b2: