SCOPe 2.07: Domain d1s6ua1: 1s6u A:1-72

Lineage for d1s6ua1 (1s6u A:1-72)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Menkes copper-transporting ATPase [55012] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)

8. Domain d1s6ua1: 1s6u A:1-72 [98608]
   Other proteins in same PDB: d1s6ua2
   2nd metal-binding domain
   complexed with cu1

Details for d1s6ua1

PDB Entry: 1s6u

PDB Description: solution structure and backbone dynamics of the cu(i) form of the second metal-binding domain of the menkes protein atp7a

PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1s6ua1:

Sequence; same for both SEQRES and ATOM records:

>d1s6ua1 d.58.17.1 (A:1-72) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkq
ieamgfpafvkk

Timeline for d1s6ua1:

• d1s6ua1 first appeared in SCOP 1.67, called d1s6ua_
  
• d1s6ua1 appears in SCOPe 2.06
  
• d1s6ua1 appears in the current release, SCOPe 2.08