Lineage for d1s6ta_ (1s6t A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393658Family c.37.1.5: PAPS sulfotransferase [52575] (10 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 393683Protein Heparan sulfate 3-O-sulfotransferase [102354] (1 species)
  7. 393684Species Mouse (Mus musculus) [TaxId:10090] [102355] (1 PDB entry)
  8. 393685Domain d1s6ta_: 1s6t A: [98605]

Details for d1s6ta_

PDB Entry: 1s6t (more details), 2.5 Å

PDB Description: Crystal structure of heparan sulfate 3-O-sulfotransferase isoform 1 in the presence of PAP

SCOP Domain Sequences for d1s6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6ta_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus)}
stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
hepnkkffklvgrtfdwh

SCOP Domain Coordinates for d1s6ta_:

Click to download the PDB-style file with coordinates for d1s6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ta_:

  • d1s6ta_ is new in SCOP 1.67
  • d1s6ta_ became obsolete in SCOP 1.69