SCOP 1.75: Domain d1s5yc_: 1s5y C:

Lineage for d1s5yc_ (1s5y C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (7 PDB entries)

8. Domain d1s5yc_: 1s5y C: [98589]
   Other proteins in same PDB: d1s5yb_, d1s5yd_
   complexed with ace, hem

Details for d1s5yc_

PDB Entry: 1s5y, 2.5 Å

PDB Description: the crystal structure of trematomus bernacchii hemoglobin oxidized by ferricyanide

PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d1s5yc_:

Sequence; same for both SEQRES and ATOM records:

>d1s5yc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1s5yc_:

• d1s5yc_ first appeared in SCOP 1.67
  
• d1s5yc_ appears in SCOP 1.73
  
• d1s5yc_ appears in SCOPe 2.01
  
• d1s5yc_ appears in the current release, SCOPe 2.08