SCOPe 2.01: Domain d1s5yb_: 1s5y B:

Lineage for d1s5yb_ (1s5y B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (9 PDB entries)

8. Domain d1s5yb_: 1s5y B: [98588]
   Other proteins in same PDB: d1s5ya_, d1s5yc_
   complexed with hem

Details for d1s5yb_

PDB Entry: 1s5y, 2.5 Å

PDB Description: the crystal structure of trematomus bernacchii hemoglobin oxidized by ferricyanide

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1s5yb_:

Sequence, based on SEQRES records:

>d1s5yb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkq

Sequence, based on observed residues (ATOM records):

>d1s5yb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgaiignanvaahgikvl
hgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqg
afqkflavvvsalgkq

Timeline for d1s5yb_:

• d1s5yb_ first appeared in SCOP 1.67
  
• d1s5yb_ appears in SCOP 1.75
  
• d1s5yb_ appears in SCOPe 2.02
  
• d1s5yb_ appears in the current release, SCOPe 2.08