Lineage for d1s4ee2 (1s4e E:181-352)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604708Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 604758Family d.58.26.7: Galactokinase [103011] (1 protein)
  6. 604759Protein Galactokinase [103012] (3 species)
  7. 604760Species Archaeon Pyrococcus furiosus [TaxId:2261] [103014] (1 PDB entry)
  8. 604765Domain d1s4ee2: 1s4e E:181-352 [98486]
    Other proteins in same PDB: d1s4ea1, d1s4eb1, d1s4ec1, d1s4ed1, d1s4ee1, d1s4ef1, d1s4eg1, d1s4eh1, d1s4ei1

Details for d1s4ee2

PDB Entry: 1s4e (more details), 2.9 Å

PDB Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium

SCOP Domain Sequences for d1s4ee2:

Sequence, based on SEQRES records: (download)

>d1s4ee2 d.58.26.7 (E:181-352) Galactokinase {Archaeon Pyrococcus furiosus}
dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv

Sequence, based on observed residues (ATOM records): (download)

>d1s4ee2 d.58.26.7 (E:181-352) Galactokinase {Archaeon Pyrococcus furiosus}
dvsvlvfytgvkelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyi
vrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygar
ltgagfggsaialvdkdkaktigdailylakfswkakyfvvkpsdgvgv

SCOP Domain Coordinates for d1s4ee2:

Click to download the PDB-style file with coordinates for d1s4ee2.
(The format of our PDB-style files is described here.)

Timeline for d1s4ee2: