Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) common fold is elaborated with additional secondary structures |
Family d.58.26.7: Galactokinase [103011] (1 protein) |
Protein Galactokinase [103012] (3 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [103014] (1 PDB entry) |
Domain d1s4ee2: 1s4e E:181-352 [98486] Other proteins in same PDB: d1s4ea1, d1s4eb1, d1s4ec1, d1s4ed1, d1s4ee1, d1s4ef1, d1s4eg1, d1s4eh1, d1s4ei1 |
PDB Entry: 1s4e (more details), 2.9 Å
SCOP Domain Sequences for d1s4ee2:
Sequence, based on SEQRES records: (download)
>d1s4ee2 d.58.26.7 (E:181-352) Galactokinase {Archaeon Pyrococcus furiosus} dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
>d1s4ee2 d.58.26.7 (E:181-352) Galactokinase {Archaeon Pyrococcus furiosus} dvsvlvfytgvkelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyi vrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygar ltgagfggsaialvdkdkaktigdailylakfswkakyfvvkpsdgvgv
Timeline for d1s4ee2: