Lineage for d1s3se2 (1s3s E:201-458)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849397Protein Membrane fusion ATPase VCP/p97 [64038] (1 species)
  7. 1849398Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries)
  8. 1849412Domain d1s3se2: 1s3s E:201-458 [98452]
    Other proteins in same PDB: d1s3sa1, d1s3sa3, d1s3sb1, d1s3sb3, d1s3sc1, d1s3sc3, d1s3sd1, d1s3sd3, d1s3se1, d1s3se3, d1s3sf1, d1s3sf3, d1s3sg_, d1s3sh_, d1s3si_
    D1 domain from the N-D1 fragment
    complexed with adp

Details for d1s3se2

PDB Entry: 1s3s (more details), 2.9 Å

PDB Description: Crystal structure of AAA ATPase p97/VCP ND1 in complex with p47 C
PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]

SCOPe Domain Sequences for d1s3se2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3se2 c.37.1.20 (E:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}
vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsq

SCOPe Domain Coordinates for d1s3se2:

Click to download the PDB-style file with coordinates for d1s3se2.
(The format of our PDB-style files is described here.)

Timeline for d1s3se2: