Class g: Small proteins [56992] (79 folds) |
Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) |
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
Species Bacillus globisporus [TaxId:1459] [103619] (1 PDB entry) |
Domain d1s3ga2: 1s3g A:126-160 [98434] Other proteins in same PDB: d1s3ga1 complexed with ap5, zn |
PDB Entry: 1s3g (more details), 2.25 Å
SCOP Domain Sequences for d1s3ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus} grrickvcgtsyhllfnppqvegkcdkdggelyqr
Timeline for d1s3ga2: