Lineage for d1s32h_ (1s32 H:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909345Protein Histone H2B [47119] (6 species)
  7. 909346Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries)
  8. 909350Domain d1s32h_: 1s32 H: [98419]
    Other proteins in same PDB: d1s32a_, d1s32b_, d1s32c_, d1s32e_, d1s32f_, d1s32g_
    protein/DNA complex; complexed with cl, imt, mn, ogg

Details for d1s32h_

PDB Entry: 1s32 (more details), 2.05 Å

PDB Description: molecular recognition of the nucleosomal 'supergroove'
PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d1s32h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s32h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
krrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrs
titsreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1s32h_:

Click to download the PDB-style file with coordinates for d1s32h_.
(The format of our PDB-style files is described here.)

Timeline for d1s32h_: