Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (5 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
Domain d1s32b_: 1s32 B: [98413] Other proteins in same PDB: d1s32a_, d1s32c_, d1s32d_, d1s32e_, d1s32g_, d1s32h_ protein/DNA complex; complexed with cl, imt, mn, ogg |
PDB Entry: 1s32 (more details), 2.05 Å
SCOPe Domain Sequences for d1s32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s32b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv tamdvvyalkrqgrtlygfgg
Timeline for d1s32b_: