Lineage for d1s32b_ (1s32 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909520Protein Histone H4 [47125] (5 species)
  7. 909521Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)
  8. 909527Domain d1s32b_: 1s32 B: [98413]
    Other proteins in same PDB: d1s32a_, d1s32c_, d1s32d_, d1s32e_, d1s32g_, d1s32h_
    protein/DNA complex; complexed with cl, imt, mn, ogg

Details for d1s32b_

PDB Entry: 1s32 (more details), 2.05 Å

PDB Description: molecular recognition of the nucleosomal 'supergroove'
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1s32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s32b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
tamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1s32b_:

Click to download the PDB-style file with coordinates for d1s32b_.
(The format of our PDB-style files is described here.)

Timeline for d1s32b_: