Lineage for d1s2qb1 (1s2q B:3-289,B:402-496)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109396Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2109510Protein Monoamine oxidase B [69423] (2 species)
  7. 2109511Species Human (Homo sapiens) [TaxId:9606] [69424] (39 PDB entries)
  8. 2109561Domain d1s2qb1: 1s2q B:3-289,B:402-496 [98397]
    Other proteins in same PDB: d1s2qa2, d1s2qb2
    complexed with fad, ras

Details for d1s2qb1

PDB Entry: 1s2q (more details), 2.07 Å

PDB Description: Crystal structure of MAOB in complex with N-propargyl-1(R)-aminoindan (Rasagiline)
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1s2qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2qb1 c.3.1.2 (B:3-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrli

SCOPe Domain Coordinates for d1s2qb1:

Click to download the PDB-style file with coordinates for d1s2qb1.
(The format of our PDB-style files is described here.)

Timeline for d1s2qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2qb2