Lineage for d1s2qa2 (1s2q A:290-401)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408639Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 408640Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 408786Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 408803Protein Monoamine oxidase B [69673] (2 species)
  7. 408804Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries)
  8. 408811Domain d1s2qa2: 1s2q A:290-401 [98396]
    Other proteins in same PDB: d1s2qa1, d1s2qb1

Details for d1s2qa2

PDB Entry: 1s2q (more details), 2.07 Å

PDB Description: Crystal structure of MAOB in complex with N-propargyl-1(R)-aminoindan (Rasagiline)

SCOP Domain Sequences for d1s2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2qa2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens)}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1s2qa2:

Click to download the PDB-style file with coordinates for d1s2qa2.
(The format of our PDB-style files is described here.)

Timeline for d1s2qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2qa1