Lineage for d1s24a_ (1s24 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587775Protein Two-iron rubredoxin [103620] (1 species)
  7. 2587776Species Pseudomonas oleovorans [TaxId:301] [103621] (1 PDB entry)
  8. 2587777Domain d1s24a_: 1s24 A: [98366]
    second domain
    complexed with cd

Details for d1s24a_

PDB Entry: 1s24 (more details)

PDB Description: Rubredoxin domain II from Pseudomonas oleovorans
PDB Compounds: (A:) Rubredoxin 2

SCOPe Domain Sequences for d1s24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]}
aylkwicitcghiydealgdeaegftpgtrfedipddwccpdcgatkedyvlyeek

SCOPe Domain Coordinates for d1s24a_:

Click to download the PDB-style file with coordinates for d1s24a_.
(The format of our PDB-style files is described here.)

Timeline for d1s24a_: