Lineage for d1s20b1 (1s20 B:1-332)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529345Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2529346Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2529347Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 2529348Protein 2,3-diketogulonate oxidoreductase (YiaK) [89735] (1 species)
  7. 2529349Species Escherichia coli [TaxId:562] [89736] (2 PDB entries)
  8. 2529353Domain d1s20b1: 1s20 B:1-332 [98357]
    Other proteins in same PDB: d1s20a2, d1s20b2, d1s20c2, d1s20d2, d1s20e2, d1s20f2, d1s20g2, d1s20h2
    structural genomics
    complexed with nad, tla

Details for d1s20b1

PDB Entry: 1s20 (more details), 2.2 Å

PDB Description: a novel nad binding protein revealed by the crystal structure of e. coli 2,3-diketogulonate reductase (yiak) northeast structural genomics consortium target er82
PDB Compounds: (B:) Hypothetical oxidoreductase yiaK

SCOPe Domain Sequences for d1s20b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s20b1 c.122.1.1 (B:1-332) 2,3-diketogulonate oxidoreductase (YiaK) {Escherichia coli [TaxId: 562]}
mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
rlpghefttllaenrrngitvddsvwakiqal

SCOPe Domain Coordinates for d1s20b1:

Click to download the PDB-style file with coordinates for d1s20b1.
(The format of our PDB-style files is described here.)

Timeline for d1s20b1: