Lineage for d1s1qa_ (1s1q A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857186Family d.20.1.2: UEV domain [75383] (2 proteins)
  6. 857187Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 857188Species Human (Homo sapiens) [TaxId:9606] [75385] (6 PDB entries)
  8. 857189Domain d1s1qa_: 1s1q A: [98351]
    Other proteins in same PDB: d1s1qb_, d1s1qd_

Details for d1s1qa_

PDB Entry: 1s1q (more details), 2 Å

PDB Description: TSG101(UEV) domain in complex with Ubiquitin
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOP Domain Sequences for d1s1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfs

SCOP Domain Coordinates for d1s1qa_:

Click to download the PDB-style file with coordinates for d1s1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1qa_: