![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins) |
![]() | Protein Potassium channel kv4.3 [102924] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102925] (1 PDB entry) |
![]() | Domain d1s1gb_: 1s1g B: [98347] complexed with zn |
PDB Entry: 1s1g (more details), 2.6 Å
SCOPe Domain Sequences for d1s1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1gb_ d.42.1.2 (B:) Potassium channel kv4.3 {Human (Homo sapiens) [TaxId: 9606]} qdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnf yrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenlehh
Timeline for d1s1gb_: