Lineage for d1s1cy1 (1s1c Y:947-1014)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591309Superfamily h.1.27: G protein-binding domain [103652] (2 families) (S)
  5. 2591310Family h.1.27.1: RhoA-binding domain [103653] (1 protein)
  6. 2591311Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species)
  7. 2591315Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry)
  8. 2591317Domain d1s1cy1: 1s1c Y:947-1014 [98343]
    Other proteins in same PDB: d1s1ca_, d1s1cb_, d1s1cx2, d1s1cy2
    complexed with gnp, mg

Details for d1s1cy1

PDB Entry: 1s1c (more details), 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI
PDB Compounds: (Y:) Rho-associated, coiled-coil containing protein kinase 1

SCOPe Domain Sequences for d1s1cy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1cy1 h.1.27.1 (Y:947-1014) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens) [TaxId: 9606]}
mltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavnkl
aeimnrkd

SCOPe Domain Coordinates for d1s1cy1:

Click to download the PDB-style file with coordinates for d1s1cy1.
(The format of our PDB-style files is described here.)

Timeline for d1s1cy1: