SCOPe 2.06: Domain d1s1cx1: 1s1c X:947-1013

Lineage for d1s1cx1 (1s1c X:947-1013)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.27: G protein-binding domain [103652] (2 families)

5. Family h.1.27.1: RhoA-binding domain [103653] (1 protein)

6. Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry)

8. Domain d1s1cx1: 1s1c X:947-1013 [98342]
   Other proteins in same PDB: d1s1ca_, d1s1cb_, d1s1cx2, d1s1cy2
   complexed with gnp, mg

Details for d1s1cx1

PDB Entry: 1s1c, 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

PDB Compounds: (X:) Rho-associated, coiled-coil containing protein kinase 1

SCOPe Domain Sequences for d1s1cx1:

Sequence; same for both SEQRES and ATOM records:

>d1s1cx1 h.1.27.1 (X:947-1013) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens) [TaxId: 9606]}
mltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavnkl
aeimnrk

Timeline for d1s1cx1:

• d1s1cx1 first appeared in SCOP 1.67, called d1s1cx_
  
• d1s1cx1 was called d1s1cx_ in SCOPe 2.05
  
• d1s1cx1 appears in SCOPe 2.07
  
• d1s1cx1 appears in the current release, SCOPe 2.08