| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.27: G protein-binding domain [103652] (2 families) ![]() |
| Family h.1.27.1: RhoA-binding domain [103653] (1 protein) |
| Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry) |
| Domain d1s1cx_: 1s1c X: [98342] Other proteins in same PDB: d1s1ca_, d1s1cb_ |
PDB Entry: 1s1c (more details), 2.6 Å
SCOP Domain Sequences for d1s1cx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1cx_ h.1.27.1 (X:) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens)}
gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
klaeimnrk
Timeline for d1s1cx_: