Lineage for d1s1cx_ (1s1c X:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 626602Superfamily h.1.27: G protein-binding domain [103652] (2 families) (S)
  5. 626603Family h.1.27.1: RhoA-binding domain [103653] (1 protein)
  6. 626604Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species)
  7. 626608Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry)
  8. 626609Domain d1s1cx_: 1s1c X: [98342]
    Other proteins in same PDB: d1s1ca_, d1s1cb_

Details for d1s1cx_

PDB Entry: 1s1c (more details), 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

SCOP Domain Sequences for d1s1cx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1cx_ h.1.27.1 (X:) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens)}
gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
klaeimnrk

SCOP Domain Coordinates for d1s1cx_:

Click to download the PDB-style file with coordinates for d1s1cx_.
(The format of our PDB-style files is described here.)

Timeline for d1s1cx_: