SCOP 1.71: Domain d1s1cx_: 1s1c X:

Lineage for d1s1cx_ (1s1c X:)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.27: G protein-binding domain [103652] (2 families)

5. Family h.1.27.1: RhoA-binding domain [103653] (1 protein)

6. Protein Rho-associated, coiled-coil containing protein kinase [103654] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103656] (1 PDB entry)

8. Domain d1s1cx_: 1s1c X: [98342]
   Other proteins in same PDB: d1s1ca_, d1s1cb_

Details for d1s1cx_

PDB Entry: 1s1c, 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

SCOP Domain Sequences for d1s1cx_:

Sequence; same for both SEQRES and ATOM records:

>d1s1cx_ h.1.27.1 (X:) Rho-associated, coiled-coil containing protein kinase {Human (Homo sapiens)}
gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
klaeimnrk

Timeline for d1s1cx_:

• d1s1cx_ first appeared in SCOP 1.67
  
• d1s1cx_ appears in SCOP 1.69
  
• d1s1cx_ appears in SCOP 1.73
  
• d1s1cx_ appears in the current release, SCOPe 2.08, called d1s1cx1