SCOP 1.71: Domain d1s1cb_: 1s1c B:

Lineage for d1s1cb_ (1s1c B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (12 PDB entries)

8. Domain d1s1cb_: 1s1c B: [98341]
   Other proteins in same PDB: d1s1cx_, d1s1cy_
   complexed with gtn, mg

Details for d1s1cb_

PDB Entry: 1s1c, 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

SCOP Domain Sequences for d1s1cb_:

Sequence; same for both SEQRES and ATOM records:

>d1s1cb_ c.37.1.8 (B:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

Timeline for d1s1cb_:

• d1s1cb_ first appeared in SCOP 1.67
  
• d1s1cb_ appears in SCOP 1.69
  
• d1s1cb_ appears in SCOP 1.73
  
• d1s1cb_ appears in the current release, SCOPe 2.08