Lineage for d1s1ca_ (1s1c A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582287Protein RhoA [52612] (1 species)
  7. 582288Species Human (Homo sapiens) [TaxId:9606] [52613] (12 PDB entries)
  8. 582296Domain d1s1ca_: 1s1c A: [98340]
    Other proteins in same PDB: d1s1cx_, d1s1cy_

Details for d1s1ca_

PDB Entry: 1s1c (more details), 2.6 Å

PDB Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI

SCOP Domain Sequences for d1s1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ca_ c.37.1.8 (A:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOP Domain Coordinates for d1s1ca_:

Click to download the PDB-style file with coordinates for d1s1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ca_: