SCOPe 2.08: Domain d1s14b_: 1s14 B:

Lineage for d1s14b_ (1s14 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)

6. Protein Topoisomerase IV subunit B [103228] (1 species)

7. Species Escherichia coli [TaxId:562] [103229] (2 PDB entries)

8. Domain d1s14b_: 1s14 B: [98330]
   complexed with nov

Details for d1s14b_

PDB Entry: 1s14, 2 Å

PDB Description: Crystal structure of Escherichia coli Topoisomerase IV ParE 24kDa subunit

PDB Compounds: (B:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d1s14b_:

Sequence; same for both SEQRES and ATOM records:

>d1s14b_ d.122.1.2 (B:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}
epvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgmpv
dihpeegvpavelilcisvvnalskrvevnvrrdgqvyniafengekvqdlqvvgtcgkr
ntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwcyqd

Timeline for d1s14b_:

• d1s14b_ first appeared in SCOP 1.67
  
• d1s14b_ appears in SCOPe 2.07