SCOPe 2.05: Domain d1s0wd_: 1s0w D:

Lineage for d1s0wd_ (1s0w D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold
   automatically mapped to Pfam PF07467

6. Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [55651] (2 PDB entries)

8. Domain d1s0wd_: 1s0w D: [98312]
   Other proteins in same PDB: d1s0wa_, d1s0wb_
   complexed with ca

Details for d1s0wd_

PDB Entry: 1s0w, 2.3 Å

PDB Description: 1b lactamse/ b lactamase inhibitor

PDB Compounds: (D:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d1s0wd_:

Sequence; same for both SEQRES and ATOM records:

>d1s0wd_ d.98.1.1 (D:) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv

Timeline for d1s0wd_:

• d1s0wd_ first appeared in SCOP 1.67
  
• d1s0wd_ appears in SCOPe 2.04
  
• d1s0wd_ appears in SCOPe 2.06
  
• d1s0wd_ appears in the current release, SCOPe 2.08