Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species) includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211) |
Species Methanococcus jannaschii [TaxId:2190] [102365] (1 PDB entry) |
Domain d1s0ua3: 1s0u A:34-229 [98304] Other proteins in same PDB: d1s0ua1, d1s0ua2 structural genomics complexed with zn |
PDB Entry: 1s0u (more details), 2.4 Å
SCOPe Domain Sequences for d1s0ua3:
Sequence, based on SEQRES records: (download)
>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Methanococcus jannaschii [TaxId: 2190]} sqaevnigmvghvdhgktsltkaltgvwtdrhseelrrgisirlgyadceirkcpqcgty ttkprcpnclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtk ehlmaleilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipisahhean idvllkaiqdfiptpk
>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Methanococcus jannaschii [TaxId: 2190]} sqaevnigmvghvdhgktsltkaltgvwtdrgisirlgyadceirkcpqcgtyttkprcp nclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtkehlmale ilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipinidvllkaiqdfip tpk
Timeline for d1s0ua3: