SCOP 1.75: Domain d1s0mb2: 1s0m B:1-240

Lineage for d1s0mb2 (1s0m B:1-240)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)

8. Domain d1s0mb2: 1s0m B:1-240 [98293]
   Other proteins in same PDB: d1s0ma1, d1s0mb1
   complexed with atp, bpa, ca, mg

Details for d1s0mb2

PDB Entry: 1s0m, 2.7 Å

PDB Description: crystal structure of a benzo[a]pyrene diol epoxide adduct in a ternary complex with a dna polymerase

PDB Compounds: (B:) DNA polymerase IV

SCOP Domain Sequences for d1s0mb2:

Sequence; same for both SEQRES and ATOM records:

>d1s0mb2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d1s0mb2:

• d1s0mb2 first appeared in SCOP 1.67
  
• d1s0mb2 appears in SCOP 1.73
  
• d1s0mb2 appears in SCOPe 2.01
  
• d1s0mb2 appears in the current release, SCOPe 2.08