Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
Protein DinB homolog (DBH) [100881] (3 species) |
Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries) |
Domain d1s0mb1: 1s0m B:241-341 [98292] Other proteins in same PDB: d1s0ma2, d1s0mb2 protein/DNA complex; complexed with bap, ca, dtp, mg |
PDB Entry: 1s0m (more details), 2.7 Å
SCOPe Domain Sequences for d1s0mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0mb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d1s0mb1: