Lineage for d1s0ea2 (1s0e A:1080-1290)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464538Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 464571Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 464572Protein Botulinum neurotoxin [50402] (2 species)
  7. 464575Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (13 PDB entries)
  8. 464577Domain d1s0ea2: 1s0e A:1080-1290 [98278]
    Other proteins in same PDB: d1s0ea1, d1s0ea3, d1s0ea4

Details for d1s0ea2

PDB Entry: 1s0e (more details), 1.9 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 6.0

SCOP Domain Sequences for d1s0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ea2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOP Domain Coordinates for d1s0ea2:

Click to download the PDB-style file with coordinates for d1s0ea2.
(The format of our PDB-style files is described here.)

Timeline for d1s0ea2: