Lineage for d1s0da4 (1s0d A:534-861)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2592663Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2592677Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 2592678Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 2592679Protein Botulinum neurotoxin [58093] (2 species)
  7. 2592685Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (14 PDB entries)
  8. 2592692Domain d1s0da4: 1s0d A:534-861 [98276]
    Other proteins in same PDB: d1s0da1, d1s0da2, d1s0da3
    complexed with ca, zn

Details for d1s0da4

PDB Entry: 1s0d (more details), 2.2 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 5.5
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1s0da4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0da4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

SCOPe Domain Coordinates for d1s0da4:

Click to download the PDB-style file with coordinates for d1s0da4.
(The format of our PDB-style files is described here.)

Timeline for d1s0da4: