Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species) synonym: 7,8-diaminopelargonic acid synthase |
Species Escherichia coli [TaxId:562] [53439] (11 PDB entries) |
Domain d1s09b_: 1s09 B: [98262] complexed with na; mutant |
PDB Entry: 1s09 (more details), 1.83 Å
SCOP Domain Sequences for d1s09b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s09b_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli} mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam kmalqywqakgearqrfltfrngfhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra vqdetffc
Timeline for d1s09b_: