SCOP 1.67: Domain d1s00t1: 1s00 T:36-256

Lineage for d1s00t1 (1s00 T:36-256)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (2 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (38 PDB entries)

8. Domain d1s00t1: 1s00 T:36-256 [98252]
   Other proteins in same PDB: d1s00h2, d1s00l_, d1s00m_, d1s00r_, d1s00s_, d1s00t2
   complexed with bcl, bph, fe2, lda, spo, u10; mutant

Details for d1s00t1

PDB Entry: 1s00, 2.6 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-separated d+qaqb- state

SCOP Domain Sequences for d1s00t1:

Sequence; same for both SEQRES and ATOM records:

>d1s00t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1s00t1:

• d1s00t1 is new in SCOP 1.67
  
• d1s00t1 appears in SCOP 1.69
  
• d1s00t1 appears in the current release, SCOPe 2.08