Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries) Uniprot P02953 |
Domain d1s00m_: 1s00 M: [98249] Other proteins in same PDB: d1s00h1, d1s00h2, d1s00l_, d1s00r_, d1s00t1, d1s00t2 complexed with bcl, bph, fe2, lda, spo, u10; mutant |
PDB Entry: 1s00 (more details), 2.6 Å
SCOPe Domain Sequences for d1s00m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s00m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn h
Timeline for d1s00m_: