Lineage for d1rzzl_ (1rzz L:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887887Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 887888Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 887889Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
    L and M are probably related to each other
  6. 887890Protein L (light) subunit [81477] (3 species)
  7. 887891Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
    Uniprot P02954
  8. 887918Domain d1rzzl_: 1rzz L: [98240]
    Other proteins in same PDB: d1rzzh1, d1rzzh2, d1rzzm_, d1rzzs_, d1rzzt1, d1rzzt2

Details for d1rzzl_

PDB Entry: 1rzz (more details), 2.4 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (tetragonal form)
PDB Compounds: (L:) reaction center protein l chain

SCOP Domain Sequences for d1rzzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzzl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhentffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1rzzl_:

Click to download the PDB-style file with coordinates for d1rzzl_.
(The format of our PDB-style files is described here.)

Timeline for d1rzzl_: