Class b: All beta proteins [48724] (180 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries) Uniprot P11846 |
Domain d1rzzh1: 1rzz H:36-256 [98238] Other proteins in same PDB: d1rzzh2, d1rzzl_, d1rzzm_, d1rzzr_, d1rzzs_, d1rzzt2 complexed with bcl, bph, fe2, lda, spo, u10; mutant |
PDB Entry: 1rzz (more details), 2.4 Å
SCOPe Domain Sequences for d1rzzh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzzh1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
Timeline for d1rzzh1: