SCOPe 2.08: Domain d1rzzh1: 1rzz H:36-256

Lineage for d1rzzh1 (1rzz H:36-256)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d1rzzh1: 1rzz H:36-256 [98238]
   Other proteins in same PDB: d1rzzh2, d1rzzl_, d1rzzm_, d1rzzr_, d1rzzs_, d1rzzt2
   complexed with bcl, bph, fe2, lda, spo, u10; mutant

Details for d1rzzh1

PDB Entry: 1rzz, 2.4 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (tetragonal form)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1rzzh1:

Sequence; same for both SEQRES and ATOM records:

>d1rzzh1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1rzzh1:

• d1rzzh1 first appeared in SCOP 1.67
  
• d1rzzh1 appears in SCOPe 2.07