Lineage for d1rztm3 (1rzt M:386-575)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1944803Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1944980Protein DNA polymerase lambda [102943] (1 species)
  7. 1944981Species Human (Homo sapiens) [TaxId:9606] [102944] (26 PDB entries)
  8. 1944998Domain d1rztm3: 1rzt M:386-575 [98235]
    Other proteins in same PDB: d1rzta1, d1rzta2, d1rzte1, d1rzte2, d1rzti1, d1rzti2, d1rztm1, d1rztm2
    protein/DNA complex; complexed with edo, na

Details for d1rztm3

PDB Entry: 1rzt (more details), 2.1 Å

PDB Description: crystal structure of dna polymerase lambda complexed with a two nucleotide gap dna molecule
PDB Compounds: (M:) DNA polymerase lambda

SCOPe Domain Sequences for d1rztm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rztm3 d.218.1.2 (M:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d1rztm3:

Click to download the PDB-style file with coordinates for d1rztm3.
(The format of our PDB-style files is described here.)

Timeline for d1rztm3: