Lineage for d1rzta2 (1rzt A:329-385)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539721Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 539722Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 539840Protein DNA polymerase lambda [101253] (1 species)
  7. 539841Species Human (Homo sapiens) [TaxId:9606] [101254] (1 PDB entry)
  8. 539842Domain d1rzta2: 1rzt A:329-385 [98225]
    Other proteins in same PDB: d1rzta1, d1rzta3, d1rzte1, d1rzte3, d1rzti1, d1rzti3, d1rztm1, d1rztm3

Details for d1rzta2

PDB Entry: 1rzt (more details), 2.1 Å

PDB Description: crystal structure of dna polymerase lambda complexed with a two nucleotide gap dna molecule

SCOP Domain Sequences for d1rzta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzta2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens)}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOP Domain Coordinates for d1rzta2:

Click to download the PDB-style file with coordinates for d1rzta2.
(The format of our PDB-style files is described here.)

Timeline for d1rzta2: