SCOP 1.73: Domain d1rzkl2: 1rzk L:110-212

Lineage for d1rzkl2 (1rzk L:110-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzkl2: 1rzk L:110-212 [98211]
   Other proteins in same PDB: d1rzkc1, d1rzkc2, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1
   part of anti HIV-1 gp120-reactive Fab 17B
   complexed with nag; mutant

Details for d1rzkl2

PDB Entry: 1rzk, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (L:) antibody 17b, light chain

SCOP Domain Sequences for d1rzkl2:

Sequence; same for both SEQRES and ATOM records:

>d1rzkl2 b.1.1.2 (L:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1rzkl2:

• d1rzkl2 first appeared in SCOP 1.67
  
• d1rzkl2 appears in SCOP 1.71
  
• d1rzkl2 appears in SCOP 1.75
  
• d1rzkl2 appears in the current release, SCOPe 2.08