Lineage for d1rzkh1 (1rzk H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362802Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 362822Domain d1rzkh1: 1rzk H:1-113 [98208]
    Other proteins in same PDB: d1rzkc1, d1rzkc2, d1rzkg_, d1rzkh2, d1rzkl1, d1rzkl2
    part of anti HIV-1 gp120-reactive Fab 17B
    complexed with nag; mutant

Details for d1rzkh1

PDB Entry: 1rzk (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzkh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

SCOP Domain Coordinates for d1rzkh1:

Click to download the PDB-style file with coordinates for d1rzkh1.
(The format of our PDB-style files is described here.)

Timeline for d1rzkh1: