Lineage for d1rzkg_ (1rzk G:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421819Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 421820Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 421821Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 421822Protein gp120 core [56504] (1 species)
  7. 421823Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (5 PDB entries)
  8. 421828Domain d1rzkg_: 1rzk G: [98207]
    Other proteins in same PDB: d1rzkc1, d1rzkc2, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2
    complexed with nag; mutant

Details for d1rzkg_

PDB Entry: 1rzk (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzkg_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

SCOP Domain Coordinates for d1rzkg_:

Click to download the PDB-style file with coordinates for d1rzkg_.
(The format of our PDB-style files is described here.)

Timeline for d1rzkg_: