Lineage for d1rzkc2 (1rzk C:98-181)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 786984Protein CD4 C2-set domains [49149] (2 species)
  7. 786985Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 787003Domain d1rzkc2: 1rzk C:98-181 [98206]
    Other proteins in same PDB: d1rzkc1, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2
    domain 2
    complexed with nag; mutant

Details for d1rzkc2

PDB Entry: 1rzk (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1rzkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzkc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1rzkc2:

Click to download the PDB-style file with coordinates for d1rzkc2.
(The format of our PDB-style files is described here.)

Timeline for d1rzkc2: